Turok 2: Seeds Of Evil Cheats

  |  Game Cheats | PC | PS3 | PS2 | PSP | Wii | Xbox 360 | Xbox | NDS | GC | GBA | GB
Contact Us | Links | Search
  3DO Cheats
  Amiga Cheats
  Arcade Cheats
  Dreamcast Cheats
  DVD Cheats
  Game Boy Cheats
  Game Boy Advance Cheats
  Game Boy Color Cheats
  GameCube Cheats
  Genesis Cheats
  Macintosh Cheats
  NES Cheats
  Nintendo 64 Cheats
  Nintendo DS Cheats
  PC Cheats
  PlayStation Cheats
  PlayStation 2 Cheats
  PlayStation 3 Cheats
  Saturn Cheats
  Sony PSP Cheats
  Super Nintendo Cheats
  Wii Cheats
  Xbox Cheats
  Xbox 360 Cheats

Bookmark and Share
Recommended
  Lyrics

Top Cheats
Guitar Hero 5
Sims
Grand Theft Auto IV: The Lost and Damned
Grand Theft Auto 3
Tennis 2K2
Star Wars: Battlefront
Tony Hawk's Pro Skater 2
James Bond 007: Quantum Of Solace
Need for Speed Underground 2
Guitar Hero
Need for Speed Carbon
Fate (WildTangent)
Midnight Club: Los Angeles
Call Of Duty 5: World At War
The Sims 2
Spore
The Sims Bustin Out
The Simpsons: Hit and Run
Black
NBA 2K9

Game Boy Cheats List
0-9ABCDEFGHIJKLMNOPQRSTUVWXYZ        
  Game Cheats    Game Boy Cheats    Turok 2: Seeds Of Evil Cheats
  

Game Boy - Turok 2: Seeds Of Evil Cheats

 Buy Game Boy Platform | Game Boy Games Store | Search Turok 2: Seeds Of Evil Video Game
 Review Turok 2: Seeds Of Evil Cheats    1 | 2 | 3 | 4 | 5  (click on the numbers)

 Current 0 Reviews , Be the first.



Turok 2: Seeds Of Evil Game Cheats ( Game Boy )

 
  • Level select

    Enter "DLVTRKBLVL" as a password.

  • Infinite lives

    Enter "DLVTRKBLVS" as a password.

  • Infinite health

    Enter "DLVTRKBNRG" as a password.

  • All weapons

    Enter "DLVTRKBWPS" as a password.

  • Bird mode

    Enter "DLVTRKBBRD" as a password. Then while playing game, hold Select and press A to fly.

  • Powerful weapons

    Enter "QVZLBVSQLV" as a password and play the game on the medium difficulty setting. Intentionally lose all lives, then re-enter the same password. Begin a new game on the easy difficulty setting, then intentionally lose all lives. Begin another new game on the easy difficulty setting, then collect the light burden. Your character will now possess the particle accelerator and the chain gun. Note: Collect the pistol on level 2 to get ammunition for the chain gun.

  • Alternate end sequence

    When the enemy appears in level 9, press Down. After entering the tunnel, shoot the computer and destroy the incubator. Then an alternate ending sequence will begin.

  • Level passwords

    Level
    EasyMediumHard
    2
    DVYLWKVYNLQVYLWKVYDTDLTLWKVYYC
    3
    GRYLWKWVNRTRYLWKWVNNGNYLWKWVPP
    4
    DRYLSRWVRYQRYLSRWVTSDNYLSRWVPT
    5
    GVZLSRWQKZTVZLSRSQKBGLZLSRSVPW
    6
    DVZLSVQKKQVZLBVSQRLDLZLBVSVVB
    7
    GRZLBVSQZYTRZLBVBQKBGNZLBVBQVL
    8
    DRZLBVSQGGQRZLBVBQKSDNZLBVBQVN
    9
    GVYNBVBQGDTVYNBVBQRLGLYNBVBQQD


    Game Shark Codes

    Note: You must have a 2.1 or higher version of the Game Shark to use these codes in a Game Boy Color system.

    Infinite Lives010AABC1
    Infinite Health0163A9C1



     
     Printable Turok 2: Seeds Of Evil Cheats
  •  Turok 2: Seeds Of Evil Cheats User Comments

         No comments yet for Turok 2: Seeds Of Evil cheats, be the first.


    Submit your comments on our Turok 2: Seeds Of Evil cheats above or New Turok 2: Seeds Of Evil cheats, codes or hints below.
    Name :
    Email :
    Game :
    Subject:
    Review&Comments
    / Cheats:
      CAPTCHA Image
       Enter the text above :
    Reload the Image
       
        Top Game Boy Cheats Codes

    Game Boy - Hot Wheels: Stunt Track Driver Cheats
    Game Boy - Metal Gear Solid Cheats
    Game Boy - Return Of The Ninja Cheats
    Game Boy - NFL Blitz Cheats
    Game Boy - NFL Blitz 2001 Cheats
    Game Boy - Street Fighter Alpha: Warriors Dreams Cheats
    Game Boy - Turok: Rage Wars Cheats
    Game Boy - Las Vegas Cool Hand Cheats
    Game Boy - Army Men: Sarge's Heroes 2 Cheats
    Game Boy - MTV Sports: Skateboarding Cheats
    Game Boy - The Mummy Returns Cheats
    Game Boy - Dragon Dance Cheats
    Game Boy - Sabrina The Animated Series: Zapped Cheats
    Game Boy - Inspector Gadget Cheats
    Game Boy - Power Rangers: Time Force Cheats

        Back to Game Boy Cheats Home    Turok 2: Seeds Of Evil Cheats

    CheatsPro.com Copyright © 2003-2010   Privacy Policy  Contact us